SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013970 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013970
Domain Number 1 Region: 272-355
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013970   Gene: ENSGGOG00000014327   Transcript: ENSGGOT00000014373
Sequence length 357
Comment pep:novel chromosome:gorGor3.1:X:104585095:104586168:1 gene:ENSGGOG00000014327 transcript:ENSGGOT00000014373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRDSYQHYFYDYDGGEDFYRSTTPSEDIWKKFELVPPPWDLGPAAGNPALGFGLLEPWP
VGCAGDETESQDYWKAWDANYASLIRRDCMWSGFSTQEPLERAVSDLLAVGAPSGYSPKE
FATPDYTPELEAGNLAPIFPCLLGEPKIQACSRSESPSDSEGEEIDVTVKKRQSLSTRKP
VIIAVRADLLDPRMNLFHISIHQQQHNYAAPFPPESCFQEGAPKRMPPKEALEIEAPGGK
DDKEDEDIVSLPPAESEAAQSCQPKPIHYDTENWTRKYHSSLERKRRNDQRSRFLALRDE
VPALASCSRVSKVMILVKATEYLQELAEAEERMATEKRQLECQRRQLQKRIEYLSSY
Download sequence
Identical sequences XP_018874672.1.27298 ENSGGOP00000013970 ENSGGOP00000013970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]