SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013983 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013983
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-47
Family Dual specificity phosphatase-like 0.0000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013983   Gene: ENSGGOG00000014340   Transcript: ENSGGOT00000014387
Sequence length 211
Comment pep:known_by_projection chromosome:gorGor3.1:8:33698374:33704726:-1 gene:ENSGGOG00000014340 transcript:ENSGGOT00000014387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWTSMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences G3REJ5
XP_018888427.1.27298 XP_018888428.1.27298 ENSGGOP00000013983 ENSGGOP00000013983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]