SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014025 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014025
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-16
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 253-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000481
Family LIM domain 0.00091
Further Details:      
 
Domain Number 3 Region: 220-252
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000973
Family LIM domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014025   Gene: ENSGGOG00000014381   Transcript: ENSGGOT00000014430
Sequence length 297
Comment pep:known_by_projection chromosome:gorGor3.1:10:108524577:108558813:-1 gene:ENSGGOG00000014381 transcript:ENSGGOT00000014430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRIKGCTDNLTLTVARSEHKVWSPL
VTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVITNQYNNPAGLYS
SENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPKQ
STSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFV
KLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK
Download sequence
Identical sequences G3REN5
ENSPTRP00000004858 ENSPTRP00000004858 9598.ENSPTRP00000004858 ENSGGOP00000014025 ENSGGOP00000014025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]