SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014035 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014035
Domain Number 1 Region: 3-298
Classification Level Classification E-value
Superfamily PP2C-like 1.44e-89
Family PP2C-like 0.000000000347
Further Details:      
 
Domain Number 2 Region: 301-373
Classification Level Classification E-value
Superfamily Protein serine/threonine phosphatase 2C, C-terminal domain 1.83e-25
Family Protein serine/threonine phosphatase 2C, C-terminal domain 0.0000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014035   Gene: ENSGGOG00000014395   Transcript: ENSGGOT00000014440
Sequence length 479
Comment pep:known_by_projection chromosome:gorGor3.1:2a:44871196:44936648:1 gene:ENSGGOG00000014395 transcript:ENSGGOT00000014440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKR
NVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Download sequence
Identical sequences A0A2K5Q2B7 A0A2K6LSD5 A0A2K6RTU0 A0A2K6TLH0 G3REP4
ENSGGOP00000014035 ENSNLEP00000020446 ENSNLEP00000020445 ENSGGOP00000014035 XP_003262842.1.23891 XP_003926807.1.74449 XP_004029205.1.27298 XP_010354815.1.97406 XP_017400333.1.71028 XP_017718189.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]