SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014039 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014039
Domain Number 1 Region: 100-135
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000222
Family CCCH zinc finger 0.00023
Further Details:      
 
Domain Number 2 Region: 138-169
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000122
Family CCCH zinc finger 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014039   Gene: ENSGGOG00000014399   Transcript: ENSGGOT00000014444
Sequence length 326
Comment pep:known_by_projection chromosome:gorGor3.1:19:36809837:36812399:1 gene:ENSGGOG00000014399 transcript:ENSGGOT00000014444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTAIYESLLSLSPDVPVPSNHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS
LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY
GAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV
LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL
ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
AGVFAPPQPVAAPRRLPIFNRISVSE
Download sequence
Identical sequences ENSGGOP00000014039 ENSGGOP00000014039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]