SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014051 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014051
Domain Number 1 Region: 111-367
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-71
Family Protein kinases, catalytic subunit 0.00000000142
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014051
Domain Number - Region: 1846-1878
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0144
Family C-terminal domain of PLC-beta 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014051   Gene: ENSGGOG00000014387   Transcript: ENSGGOT00000014457
Sequence length 2212
Comment pep:known_by_projection chromosome:gorGor3.1:9:75145580:75283692:1 gene:ENSGGOG00000014387 transcript:ENSGGOT00000014457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPAGAARWACQAQPPAPVRGGANGAPPSPRAGSEPGPDPIVAAVETAPAPDGGPREEAAA
TVRKEDEGAAEAKPEPGRTRRDEPEEEEDDEDDLKAVATSLDGRFLKFDIELGRGSFKTV
YKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKR
CIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNI
FITGPTGSVKIGDLGLATLKRASFAKSVIGTGTPEFMAPEMYEEHYDESVDVYAFGMCML
EMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDL
LSHAFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETP
DEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGP
PVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSD
SQSSQQSVVLGSLADAAPPPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVP
APACPPSLQQHFPDPAMSFAPVLPPPSTPVPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQ
PVGPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPL
AGIDGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGA
PLAMPCRTIVPNAPAPIPLLAVAPPGVAALSIHSAVAQLPAQPVYPAAFPQMAPTDVPPS
PHHTVQNMRATPPQPALPPQPTLPPQPMLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLP
PQPVLPPQPALPVRPEPLQPHLPEQAAPAAAPGSQILLGHPAPYAVDVAAQVSTVPVPPA
AVLSPPLPEVLLPAAPELLPQFPSSLATVSASVQSVPTQTATLLPPANPSLPGGPGIASP
CPTVQLTVEPVQEEQASQDKPPGLPQSCESYGGSDVTSGKELSDSCEGAFGGGRLEGRAA
RGHRRGHGGVSSQQRHTVGPALTLPTVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPDE
IATYMVEHDFILQAERETFIEQMKDVMDKAEDMLSEDTDADRGSDPGTSPPHLSTCGLGA
GEESRQSQANAPVYQQNVLHTGKRWFIICPVAEHPAPEAPESSPPLPLSSLPPEASQGPC
RGLTLPCLPWRRAPCGAVFLSLFSAESAQSKQPPDSAPYKDQLSLKEQAGFLAGQQLLSQ
AGPSNPPGAPPAPLAPSSPPVTALPQDGAAPATSTMPEPASGTAIQAGGPGTPQGLTSEL
ETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAASTRDASAPREPLPPPVPEPSPHSGTPQ
PALGQPAPLLPAAVGAVSLATSQLPSPPLGPTVPPQPPSALESDGEGPPPRVGFVDSTIK
SLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDFTLEPLRGDQPRSEVCGGDLALPPVPKE
AVSGRAQLPQPLVEKSELAPTRGAVMEQGMSSSMTAESSPRSMLGYDRDGRQVASDSHVV
PSIPQDVPAFVRPARVEPTDRDGGVSGESSAEPPPSDTGISTVGGQASHPQTLGARASGS
PRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEAPSSPDVKLAV
RRAQTASSIEVGVGEPVSSDSGDEGPRVRPPVQKQASLPVSGSVAGDFVKKATAFLQRPS
RAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSDNDSELEDADIKKELQSLREKHLKEI
SELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLK
VVASSTGHLADSSRGPPAKDPAQASVGLTADSTGLSGKAVQTQQPCSVRASLSSDICSGL
ASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRS
STSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQ
LKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPT
PDGALGTARRNQVWFGLRVPPTACCGHSTQPRGGQRVGSKTASFAASDPVRS
Download sequence
Identical sequences ENSGGOP00000014051 ENSGGOP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]