SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014277 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014277
Domain Number 1 Region: 650-1006
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.9e-110
Family PDEase 0.00000226
Further Details:      
 
Domain Number 2 Region: 463-645
Classification Level Classification E-value
Superfamily GAF domain-like 6.32e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 294-476
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-33
Family GAF domain 0.0000000185
Further Details:      
 
Domain Number 4 Region: 114-266
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000216
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014277   Gene: ENSGGOG00000014611   Transcript: ENSGGOT00000014688
Sequence length 1010
Comment pep:known_by_projection chromosome:gorGor3.1:11:69500311:69582500:-1 gene:ENSGGOG00000014611 transcript:ENSGGOT00000014688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYILKMPGTCLPGEGTTYELPPSSLHPSSAPVTSGGTCPALLTEAGWEAPIMAFAEAAS
AVGPSWTHRGHSRSSSEAEQRGSVQSMGPWSLLRGQQVFLKPDEPPPPPQPCADSLQDAL
LSLGSVIDISGLQRAVKEALSAVLPQVETVYTYLLDGESQLVCEDPPHELPQEGKVREAI
ISQKRLGCNGLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSD
NEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGAAEDQKGGAAYTDRDRKIL
QLCGELYDLDASSLQLKVLQYLQQETWASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFP
LTGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFN
KLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVS
VLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVAT
TGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSK
FDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQ
PVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYR
DPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFVSCMCHDLDHRGTNNSFQVAS
KSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLA
HHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFF
SQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASN
REHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences ENSGGOP00000014277 ENSGGOP00000014277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]