SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014328 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000014328
Domain Number - Region: 18-71
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00425
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014328   Gene: ENSGGOG00000014688   Transcript: ENSGGOT00000014739
Sequence length 130
Comment pep:known_by_projection chromosome:gorGor3.1:9:111456187:111458317:-1 gene:ENSGGOG00000014688 transcript:ENSGGOT00000014739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLL
LLLFVGKSSPPPLDPGQGFRKTPPLNMLPHFGGAGSCLPGTHPWGFPVHPSRLPVSNLWV
SWCPRLFGLQ
Download sequence
Identical sequences G3RFG3
ENSGGOP00000014328 ENSGGOP00000019452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]