SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014360 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014360
Domain Number 1 Region: 28-139
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-23
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 2 Region: 145-190
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014360   Gene: ENSGGOG00000014723   Transcript: ENSGGOT00000014771
Sequence length 191
Comment pep:known_by_projection chromosome:gorGor3.1:16:11646229:11646864:-1 gene:ENSGGOG00000014723 transcript:ENSGGOT00000014771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSDTHFRTFRSHADYRRITRASALLDACGFY
WGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGS
RESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVL
RDYLSSFPFQI
Download sequence
Identical sequences ENSGGOP00000014360 ENSGGOP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]