SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014368 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014368
Domain Number 1 Region: 285-602
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.36e-121
Family Mammalian PLC 0.0000000344
Further Details:      
 
Domain Number 2 Region: 127-280
Classification Level Classification E-value
Superfamily EF-hand 7.74e-45
Family EF-hand modules in multidomain proteins 0.00022
Further Details:      
 
Domain Number 3 Region: 606-731
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.51e-29
Family PLC-like (P variant) 0.00013
Further Details:      
 
Domain Number 4 Region: 4-115
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-21
Family Pleckstrin-homology domain (PH domain) 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014368   Gene: ENSGGOG00000014717   Transcript: ENSGGOT00000014779
Sequence length 734
Comment pep:known_by_projection chromosome:gorGor3.1:5:38963631:38972334:1 gene:ENSGGOG00000014717 transcript:ENSGGOT00000014779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEDEDVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIE
AVREGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLD
AMSQRERLDPWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNN
DRLEGAEIEEFLRQLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQL
IQTYELNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTY
LTDSQIGGPSSTEAYDRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVR
DHAFTLSPYPVILSLENHCGLEQQAAMAHHLCTILGDMLVTQALDSPNPEELPSPEQLKG
RVLVKGKKLPAARSEDGRALSDREEEEEEDDEEEEEEVEAAVQRRLAKQISPELSALAVY
CHATRLRLHPAPNALQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSA
NYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYP
GPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQETDYVLNNGFNPR
WGQTLQFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASL
SPATLFIQIRIQRS
Download sequence
Identical sequences ENSGGOP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]