SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014410 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014410
Domain Number 1 Region: 18-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.52e-79
Family Pancreatic carboxypeptidases 0.000000883
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014410
Domain Number - Region: 341-370
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00114
Family Carboxypeptidase regulatory domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014410   Gene: ENSGGOG00000014771   Transcript: ENSGGOT00000014822
Sequence length 418
Comment pep:known_by_projection chromosome:gorGor3.1:10:113501018:113549362:-1 gene:ENSGGOG00000014771 transcript:ENSGGOT00000014822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLLSVFLHLLLLFKLVAPVTFRHNRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQD
TRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRT
ANTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVIS
VSGINHDVTSVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Download sequence
Identical sequences ENSGGOP00000014410 ENSGGOP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]