SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014416 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014416
Domain Number 1 Region: 127-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000432
Family Second domain of FERM 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014416   Gene: ENSGGOG00000014773   Transcript: ENSGGOT00000014828
Sequence length 464
Comment pep:known_by_projection chromosome:gorGor3.1:11:62243676:62270345:1 gene:ENSGGOG00000014773 transcript:ENSGGOT00000014828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRA
VREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDE
PFLQFRRNVFFPKRRELQIHDEEVLRLLYEEAKGNVLAVRYPCDVEDCEALGALVCRVQL
GPYQPGRLAACDLREKLDSFLPAHLCKRGQSLFAALRGRGARAGPGEQGLLNAYRQVQEV
GSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPAQGFLHRGGRKPVSVAISLEG
VHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAEL
MSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSPAPVQRPKLRRQGSVVSSRIQHLSTI
DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGGSLEQG
Download sequence
Identical sequences G3RFP3
ENSGGOP00000014416 XP_004051549.1.27298 ENSGGOP00000014416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]