SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014434 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014434
Domain Number 1 Region: 23-604
Classification Level Classification E-value
Superfamily ARM repeat 2.16e-99
Family Clathrin adaptor core protein 0.00000149
Further Details:      
 
Domain Number 2 Region: 658-783
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.12e-37
Family gamma-adaptin C-terminal appendage domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014434   Gene: ENSGGOG00000014786   Transcript: ENSGGOT00000014847
Sequence length 785
Comment pep:known_by_projection chromosome:gorGor3.1:14:4551152:4559748:-1 gene:ENSGGOG00000014786 transcript:ENSGGOT00000014847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHML
GYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPC
AQLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVQILRTLVTMGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDI
CSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVECLRETDA
SLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHI
DTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWC
IGEYGDLLLAGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCG
DNNRIRQVVSIYGSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLAERDGPQADEEAK
ESKEAAQLSEAAPVPTEPQASQLLDLLDLLDGASGDVQHPPPLDPSPGGALVHLLDLPCA
PPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITVTATNFSEGDVTHFICQAAVPKS
LQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLP
VESWQ
Download sequence
Identical sequences G3RFQ8
ENSGGOP00000014434 XP_004055018.1.27298 XP_018865184.1.27298 XP_018865185.1.27298 ENSGGOP00000014434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]