SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014453 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014453
Domain Number 1 Region: 289-396
Classification Level Classification E-value
Superfamily SCP-like 4e-21
Family Sterol carrier protein, SCP 0.0026
Further Details:      
 
Domain Number 2 Region: 108-217
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.06e-17
Family Band 7/SPFH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014453   Gene: ENSGGOG00000014814   Transcript: ENSGGOT00000014866
Sequence length 398
Comment pep:known_by_projection chromosome:gorGor3.1:15:53557884:53567028:-1 gene:ENSGGOG00000014814 transcript:ENSGGOT00000014866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADAPQSWPSCLCHGLIS
FLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLR
TRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLK
RPLREIQMEKLKISDQLLLEINDVTRAWGLEVDRMELAVEAVLQPPQDSPAGPNLDSTLQ
QLALHFLGGSMNSVAGGAPSPRPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQP
FLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDVVVEMAEADLR
ALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK
Download sequence
Identical sequences G3RFS7
XP_004056519.1.27298 ENSGGOP00000014453 ENSGGOP00000014453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]