SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014478 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014478
Domain Number 1 Region: 26-195
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.0000000000000392
Family Glycerol-3-phosphate (1)-acyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014478   Gene: ENSGGOG00000014835   Transcript: ENSGGOT00000014891
Sequence length 325
Comment pep:known_by_projection chromosome:gorGor3.1:8:6579936:6629068:1 gene:ENSGGOG00000014835 transcript:ENSGGOT00000014891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSLVLHTYSMRYLLPSVVLLGTAPTYVLAWGVWRLLSAFLPARFYQALDDRLYCVYQS
MVLFFFENYTGVQILLYGDLPKNKENIIYLANHQSTHGGIYVKRSAKFNEKEMRNKLQSY
VDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDCMK
NYLDAIYDVTVVYEGKDDGGQRRESPTMTDFLCKECPKIHIHIDRIDKKDVPEEQEHMRR
WLHERFEIKDKMLIEFYESPDPERRKRFPGKSINSKLSIKKTLPSMLILSGLTAGMLMTD
AGRKLYVNTWIYGTLLGCLWVTIKA
Download sequence
Identical sequences ENSGGOP00000014478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]