SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014513 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014513
Domain Number 1 Region: 107-187
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.18e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 18-84
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 389-437
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000959
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014513   Gene: ENSGGOG00000014875   Transcript: ENSGGOT00000014926
Sequence length 442
Comment pep:known_by_projection chromosome:gorGor3.1:18:48970117:48990717:-1 gene:ENSGGOG00000014875 transcript:ENSGGOT00000014926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIF
VVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRV
VGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTGN
YIELNEENDFHYNGTDVSFEGGTLGSAWLSSNPVPPSRARMISNYRNDSSSSLGSGSTDS
YFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVN
PLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYI
PAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENEVIAALVPCGHNLFCMECANKIC
EKRTPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences G3RFY0
ENSGGOP00000014513 ENSGGOP00000014513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]