SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014515 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014515
Domain Number 1 Region: 244-335,399-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-17
Family SPRY domain 0.035
Further Details:      
 
Domain Number 2 Region: 49-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000174
Family SPRY domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014515   Gene: ENSGGOG00000014874   Transcript: ENSGGOT00000014928
Sequence length 442
Comment pep:known_by_projection chromosome:gorGor3.1:12:51081391:51099253:-1 gene:ENSGGOG00000014874 transcript:ENSGGOT00000014928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHG
NSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHA
DDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPD
GLFPAVGMHSLGEEVRLHLNAELGREDDSVMMVDSYEDEWGRLHDVRVCGTLLEYLGKGK
SIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHA
DDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVR
NVRNVMYLHQEGEEEEEEEEEEEDGEEIEPEHEGRKVVVFFTRNGKIIGKKDAVVPSGGF
FPTIGMLSCGEKVKVDLHPLSG
Download sequence
Identical sequences A0A024RAX4 A0A096MPF6 A0A2K5HTD9 A0A2K5NQM5 A0A2K5QYQ9 A0A2K5ZMU0 A0A2K6DFB7 A0A2K6LYN0 A0A2K6Q9D4 G3RFY2 G7N735 H2NHF6 K7CJV8 Q8NCJ5
ENSPPYP00000005208 ENSGGOP00000014515 ENSGGOP00000014515 ENSP00000301463 hss001000898.1 gi|14249554|ref|NP_116229.1| ENSP00000301463 ENSPANP00000001609 NP_001125451.1.23681 NP_116229.1.87134 NP_116229.1.92137 XP_003831090.1.60992 XP_004053256.1.27298 XP_005571018.2.63531 XP_010372251.1.97406 XP_011727169.1.29376 XP_011785947.1.43180 XP_011857256.1.47321 XP_011903543.1.92194 XP_012305719.1.9421 XP_014702979.1.49734 XP_015007314.1.72884 XP_016778840.1.37143 XP_017357269.1.71028 XP_017716957.1.44346 ENSPPYP00000005208 9600.ENSPPYP00000005208 9606.ENSP00000301463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]