SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014557 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014557
Domain Number 1 Region: 466-500
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000549
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014557   Gene: ENSGGOG00000014915   Transcript: ENSGGOT00000014970
Sequence length 751
Comment pep:known_by_projection chromosome:gorGor3.1:16:1469958:1504053:-1 gene:ENSGGOG00000014915 transcript:ENSGGOT00000014970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVSKAAAAALSGPFPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQ
RRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDESLLGVLPYLLWAPPPVPAPVRAPT
VHSFLARWFSHVPWEPAGSADPRASSTPAGGTTWATSLLGDFDACGSQSQECVKGVWWTL
LGFRCPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVC
DVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQALLPVTLLRHRVA
RLSDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYPCPSVKHGDEWG
EPSRCDGGDGCQYCHSRTEQQFHPEGLVGSLVSRAFSVFSHAGLAADPSPWYPAEWSWHH
VGHSRTVNPEDKPSRLGPAPENIKRGNDFACDGRADAVGMAPRVCVFPIYKSTKCNDMRQ
TGYCPRGPFCAFAHVEKSLGMVNEWGCRDLHLTSPASTGSGSGQPGNAKRRDSPAEGGPR
GSEQDSKQGARAHGVYVFEQNHLAVFAAVHPPASSVSSSLASSAGSGSSSPTALPAPPAR
ALPLGPASSTVEAVLALEPTVSSPTSSAVQGVAGELGMGSGGQGCWSHVVGALAAVPAWT
HSGDSEWDPSTVRTRIDVGGGPAARPAMTPAREPQLLVIGGCPTRNCSGPAVSPQQLLDI
AGQGGRGERESSQRPLRPQTTHRQDTRPVSS
Download sequence
Identical sequences ENSGGOP00000014557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]