SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014588 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014588
Domain Number 1 Region: 104-434,467-617
Classification Level Classification E-value
Superfamily Clc chloride channel 2.88e-100
Family Clc chloride channel 0.00067
Further Details:      
 
Domain Number 2 Region: 619-797
Classification Level Classification E-value
Superfamily CBS-domain pair 4.19e-26
Family CBS-domain pair 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014588   Gene: ENSGGOG00000014942   Transcript: ENSGGOT00000015001
Sequence length 812
Comment pep:known_by_projection chromosome:gorGor3.1:16:1533588:1566345:-1 gene:ENSGGOG00000014942 transcript:ENSGGOT00000015001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVSKKVSWSGRDRDDEEVAPLLRRTARPGGGTPLLNGAGPGAARQSPRSALFRVGHMS
SVELDDELLDPDMDPPHPFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFR
TVEIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKGSILPGAAAAAWEGLLGLRG
CICLSLAVTHSAVLPLFQPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVG
GLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAA
FGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVLSIYHGNMWDLSSPGLINF
GRFDSEKMAYTIHEIPVFIAMGVVGGVLGAVFNALNYWLTMFRIRYIHRPCLQVIEAMLV
AAVTATVAFVLIYSSRDCQPLQGGSMSYPLQLFCADGEYNSMAAAFFNTPEKSVVSLFHD
PPGSYNPVTLGLFTLVYFFLACWTYGLTVSAGVFIPSLLIGAAWGRLFGISLSYLTGAAI
WADPGKYALMGAAAQLGGIVRMTLSLTVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEG
LYDMHIQLQSVPFLHWEAPVTSHSLTAREVMSTPVTCLRRREKVGVIVDVLSDTASNHNG
FPVVEHADDTQPARLQGLILRSQLIVLLKHKVFVERSNMGLVQRRLRLKDFRDAYPRFPP
IQSIHVSQDERECTMDLSEFMNPSPYTVPQASVPLLQEASLPRVFKLFRALGLRHLVVVD
NRNQVVGLVTRKDLARYRLGKGGLEELSLAQT
Download sequence
Identical sequences ENSGGOP00000014588 ENSGGOP00000014588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]