SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014623 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014623
Domain Number 1 Region: 1520-1543,1587-1745
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.1e-36
Family Laminin G-like module 0.000000695
Further Details:      
 
Domain Number 2 Region: 1287-1494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-32
Family Laminin G-like module 0.00053
Further Details:      
 
Domain Number 3 Region: 347-414
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.19e-17
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 4 Region: 780-849
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000079
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 5 Region: 1026-1104
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000863
Family SEA domain 0.0031
Further Details:      
 
Domain Number 6 Region: 430-479
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000222
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 7 Region: 578-629
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000887
Family Ovomucoid domain III-like 0.0042
Further Details:      
 
Domain Number 8 Region: 497-544
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000194
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 9 Region: 70-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000956
Family Ovomucoid domain III-like 0.0074
Further Details:      
 
Domain Number 10 Region: 292-341
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000194
Family Ovomucoid domain III-like 0.0051
Further Details:      
 
Domain Number 11 Region: 672-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 12 Region: 220-268
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 13 Region: 132-197
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000305
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 14 Region: 726-763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 15 Region: 1229-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000466
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014623   Gene: ENSGGOG00000014970   Transcript: ENSGGOT00000015036
Sequence length 1748
Comment pep:known_by_projection chromosome:gorGor3.1:1:892454:913955:1 gene:ENSGGOG00000014970 transcript:ENSGGOT00000015036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLPLARDTRQPPGASLLVRGFMVPCNACLILLATATLGFAVLLFLNNYKPGTHFTPVP
PTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQR
AQCSQQRRIRPCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRR
ACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDDG
VTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCLEPCRFNAVCLSRRGRPRCSCDRVTC
DGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAV
KNGQAACECLRACSSLYDPVCGSDGVTYGSACELEATACTLGREVQVARRGPCDRCGQCR
FGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQIGLHVTSAGPCET
CGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARA
GPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSD
GVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQMPYGCCQDNITAA
RGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGR
SGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATC
AEMRCEFGALCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQI
SIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPSALPLAPSSTAHSQTTPPPS
SRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGGG
SGGLEPFEGSSVATPGPPVERASCYNSALGCCSDGKTPLLDAEGSNCPATKVFQGVLELE
GVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVR
AIVDVHFDPTTAFRAPDVARALLRQIQASRRRSLGVRRPLQEHVRFMDFDWFPAFFAGAT
SGAIAAVATARATTASRLPSSAVTPRALHPSHTSQPVAKTTAAPTTRQPPTTAPSRVPGR
RPPAPQQPPKPCDSQPCFHGGXGGGGGGHPCLANPCHGGAPCQNLEAGRFHCQCPPGRVG
PTCADEKSPCQPNPCHGAAPCRVLPKGGAQCECPLGREGTFCQTASGQDGSGPFLADFNG
FSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALQDRRLEF
RYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGSLRVGDGPRVLGESPKSRKVPHTILN
LKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPC
TRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDALAFDGRTFIEYL
NAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYV
ALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHRPREQREGSLQVGNEAPVTGS
SPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKP
ELQPCPTP
Download sequence
Identical sequences ENSGGOP00000014623 ENSGGOP00000014623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]