SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014639 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014639
Domain Number 1 Region: 340-440
Classification Level Classification E-value
Superfamily E set domains 2.8e-26
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 128-186
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000163
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014639
Domain Number - Region: 168-270
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00248
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014639   Gene: ENSGGOG00000014996   Transcript: ENSGGOT00000015052
Sequence length 523
Comment pep:known_by_projection chromosome:gorGor3.1:1:120213649:120223298:-1 gene:ENSGGOG00000014996 transcript:ENSGGOT00000015052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGVTLEGGGARRGEGRPSRTELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLA
VNDVMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLK
DLKGYSRIGKPILCPVHPAEELRLFCEFCDRPVCRDCVVGEHREHPCDFTSNVIHKHGDS
VRELLKGTQPHVEALEEALAQIHIMNSALQKRVEAVAADVRTFSEGYIKAIEEHRDKLLK
QLEDIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKGVVVERLRKL
NKVQYSARPGVNDKIRFCPQEKAGQCHGYEIYGTINTKELDPAKCVLQGEDLHRAREKQT
ASFTLLCKDAAGEIMGRGGDNVQVAIVPKDKKDSPVRTVVQDNKDGTYYISYTPKEPGVY
TVWVCIKEQHVQGSPFTVTVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGC
GHGHKGHPGHPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences G3RG96
ENSGGOP00000014639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]