SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014651 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014651
Domain Number 1 Region: 141-262
Classification Level Classification E-value
Superfamily R3H domain 1.83e-43
Family R3H domain 0.000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014651   Gene: ENSGGOG00000015007   Transcript: ENSGGOT00000015064
Sequence length 1032
Comment pep:known_by_projection chromosome:gorGor3.1:12:55389017:55450825:-1 gene:ENSGGOG00000015007 transcript:ENSGGOT00000015064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEIEKECEDTSLRQETQRRTSN
HGHARKRAKSNSKLKLVRSLAVCEESSTPFADGPLETQDIIQLHISCPSDKEEEKSTKDV
SEKEDKDKNKEKIPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEIL
EFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFS
EHIKDEKNTEFQQRFILKRDDASMDRDDNQIRVPLQDGRRSKSIEEREEEYQRVRERIFA
RETGQNGYLNDIRLSKEAFSSSSHKRRQIFRGNREGLSRTSSSRQSSTDSELKSLEPRPW
SSTDSDGSVRSMRPPVTKASSFSGISILTRGDSIGSSKGGSAGRISRPGMALGAPEVCNQ
VTSSQSVRGLLPCTELPALPPTPQQQPPLNNHMISQPVPALQPSPQPVQFSPSSCPQVLL
PVSPPQQYNMADDLSNPFGQMSLSRQGSTEAADPSAALFQTPLISQHPQQTSFLMASTGQ
PLPTSNYSTSSHAPPTQQVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQYRPLSHPVAYSP
QRGQQLPQPSQQPGLQPMMPNQQQAAYQGMIGVQQPQNQGLLSGQRSSMGGQMQGLVVQY
TPLPSYQVPVGSDSQNVVQPPFQQPMLVPVSQSVQGGLPAAGVPVYYSMIPPAQQNGTSP
SVGFLQPPGSEQYQMPQSPSPCSPPQMPQQYSGVSPSGPGVVVMQLNVPNGPQPPQNPSM
VQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSPAPSPVTSLSSVCTG
LSPLPVLTQFPRPGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYTVHQGQSGLKHGN
RGKRQALKSASTDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAMSGAKIQWLKDAQ
GLPGGGGGDNSGTAENGRHSDLAALYTIVAVFPSPLAAQNASLRLNNSVSRFKLRMAKKN
YDLRILERASSQ
Download sequence
Identical sequences ENSGGOP00000014651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]