SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014652 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014652
Domain Number 1 Region: 1636-1822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-35
Family Laminin G-like module 0.00051
Further Details:      
 
Domain Number 2 Region: 1458-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1049-1229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.2e-23
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 1230-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.87e-21
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 5 Region: 833-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-18
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 6 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.0028
Further Details:      
 
Domain Number 7 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 8 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014652
Domain Number - Region: 738-806
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0249
Family FAT domain of focal adhesion kinase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014652   Gene: ENSGGOG00000015003   Transcript: ENSGGOT00000015065
Sequence length 1823
Comment pep:known_by_projection chromosome:gorGor3.1:6:112275558:112433425:-1 gene:ENSGGOG00000015003 transcript:ENSGGOT00000015065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLHNTTGFKCEHCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNHVRDAEDTNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMQVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFLGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSSGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVVMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences G3RGA8
ENSGGOP00000014652 XP_018885009.1.27298 ENSGGOP00000014652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]