SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014673 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014673
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.31e-31
Family Cytochrome b5 0.0000248
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014673
Domain Number - Region: 116-143
Classification Level Classification E-value
Superfamily Aquaporin-like 0.00235
Family Aquaporin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014673   Gene: ENSGGOG00000015031   Transcript: ENSGGOT00000015086
Sequence length 150
Comment pep:known_by_projection chromosome:gorGor3.1:16:59610302:59651127:1 gene:ENSGGOG00000015031 transcript:ENSGGOT00000015086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCK
SCWAYWILPIIGAVLLGFLYRYYTSESKSS
Download sequence
Identical sequences G3RGC9
ENSGGOP00000014673 ENSGGOP00000014673 XP_004057932.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]