SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014678 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014678
Domain Number 1 Region: 54-215
Classification Level Classification E-value
Superfamily EF-hand 2.76e-41
Family Penta-EF-hand proteins 0.000000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014678   Gene: ENSGGOG00000015043   Transcript: ENSGGOT00000015092
Sequence length 217
Comment pep:known_by_projection chromosome:gorGor3.1:2b:49989140:50010774:1 gene:ENSGGOG00000015043 transcript:ENSGGOT00000015092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILIDRYSGPAYSDTYSSTGDSVYTYFSA
VAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDYTGKMGFNAFKELWAA
LNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA
CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Download sequence
Identical sequences A0A2I2YYD0
ENSGGOP00000014678 ENSGGOP00000014678 XP_004032760.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]