SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014703 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014703
Domain Number 1 Region: 43-266
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.61e-58
Family Cytidylytransferase 0.00000000147
Further Details:      
 
Domain Number 2 Region: 271-430
Classification Level Classification E-value
Superfamily HAD-like 1.49e-22
Family Probable phosphatase YrbI 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014703   Gene: ENSGGOG00000015061   Transcript: ENSGGOT00000015117
Sequence length 434
Comment pep:known_by_projection chromosome:gorGor3.1:12:22325209:22344775:1 gene:ENSGGOG00000015061 transcript:ENSGGOT00000015117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPL
KNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSS
TSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRW
SEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEM
RAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEI
ISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDKLAVVDEWRKE
MGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCTGGRGAIREFAEH
IFLLMEKVNNSCQK
Download sequence
Identical sequences G3RGF5
XP_004052909.1.27298 ENSGGOP00000014703 ENSGGOP00000014703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]