SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014722 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014722
Domain Number 1 Region: 543-678
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-26
Family Third domain of FERM 0.0041
Further Details:      
 
Domain Number 2 Region: 437-542
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-25
Family Second domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 766-859
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-22
Family PDZ domain 0.016
Further Details:      
 
Domain Number 4 Region: 343-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000431
Family First domain of FERM 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014722
Domain Number - Region: 79-163
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00026
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014722   Gene: ENSGGOG00000015076   Transcript: ENSGGOT00000015138
Sequence length 965
Comment pep:novel chromosome:gorGor3.1:10:59950079:60046945:-1 gene:ENSGGOG00000015076 transcript:ENSGGOT00000015138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLTKDAGMSLSSVTLASALQVRGEALSEEEIWSLLFLAAEQLLEDLRNDSSDYVVCPW
SALLSAAGSLSFQGRVSHIEAAPFKAPELLQGKSEDEQPDASQMHVYSLGMTLYWSAGFH
VPPHQPLQLCEPLHSILLTMCEDQPHRRCTLQSVLEACRVHEKEVSVYPAPAGLHIRRLV
GLVLGTISEVEKRVVEESSSVQQNRSYLLRKRLHGTSSESPAAQAPECLHPCRVSERSME
TQSSPEPHWSTSTHSHCSLLVNRALPGADPQDQQEGRRLSSGSVHSAADSSWPTTPSQRG
FLQRRSKFSRPEFILLAGEAPMTLHLPGSVVTKKGKSYLALRDLCVVLLNGQHLEVKCDV
ESTVGAVFNAVTSFANLEELTYFGLAYMKSKEFFFLDSETRLCKIAPEGWREQPQKTSMN
TFTLFLRIKFFVSHYGLLQHSLTRHQFYLQLRKDILEERLYCNEEVLLQLGVLALQAEFG
NYPKEQVESKPYFHVEDYIPASLIERMTALRVQVEVSEMHRLSSALWGEEAELEFLRVTQ
QLPEYGVLVHQVFSEKRRTEEEMALGICAKGVIVYEVKNNSRIAMLRFQWRETGKISTYQ
KKFTITSSVTGKKHTFVTDSAKTSKYLLDLCSAQHGFNAQMGSGQPSHVLFDHDKFVQMA
NLSPAHQARSKPLIWIQRLSCSENELFASRLQDAAGGLLSTSLDNFNVNGSKEARAEGIG
RSPCTGREQLKSACVIQKPMTWDSLSGPPVQSMRAGSKNNRRKSFTAEPGREIVRVTLKR
DPHRGFGFVINEGEYSGQADPGIFISSIIPGGPAEKAKTIKPGGQILALNHISLEGFTFN
MAVRMIQNSPDNIELIISQSKGVGGNNPDEEKNSTANSGVSSTDILSFGYQGSLLSHTQD
QDRNTEELDMAGVQSLVPRLRHQLSFLPLKGAGSSCPPSPPEISAGEIYFVELVKEDGTL
GFSVT
Download sequence
Identical sequences ENSGGOP00000014722 ENSGGOP00000014722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]