SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014761 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000014761
Domain Number - Region: 70-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.068
Family Plexin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014761   Gene: ENSGGOG00000015128   Transcript: ENSGGOT00000015178
Sequence length 86
Comment pep:novel chromosome:gorGor3.1:2a:91260677:91261312:-1 gene:ENSGGOG00000015128 transcript:ENSGGOT00000015178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAGGTPKLARQASIELPSMAAATTKSWWEMGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQ
KGGSKTSSTIKVEPKCGWCRQEILTH
Download sequence
Identical sequences ENSGGOP00000014761 ENSGGOP00000014761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]