SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014763 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014763
Domain Number 1 Region: 71-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.23e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014763   Gene: ENSGGOG00000015133   Transcript: ENSGGOT00000015181
Sequence length 198
Comment pep:known_by_projection chromosome:gorGor3.1:20:605122:611394:-1 gene:ENSGGOG00000015133 transcript:ENSGGOT00000015181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEAARRGPGPGGGRRAG
GGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYI
AHLANVLLLGDSADDGQPCFRAAGSAKSAVPAAADGGRQPRSICTFCLSNQRKGGGRRDL
GGSCLKVRGVAPLRGPRR
Download sequence
Identical sequences G3RGL3
ENSGGOP00000014763 XP_004061691.1.27298 ENSGGOP00000014763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]