SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014764 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014764
Domain Number 1 Region: 46-141
Classification Level Classification E-value
Superfamily Cystatin/monellin 5.83e-28
Family Cystatins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014764   Gene: ENSGGOG00000015132   Transcript: ENSGGOT00000015182
Sequence length 146
Comment pep:known_by_projection chromosome:gorGor3.1:20:24163782:24167293:-1 gene:ENSGGOG00000015132 transcript:ENSGGOT00000015182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLPWKGGLPWALLLLLLGFQILLIYAWHFHKQRDCDEHNVMARYLPATVEFAVHTFNQ
QSKDYYAYRLVHINSWKEQVESKTVFSMELLLGRTRCGKLEDDTDNCPFQESTELNDTFT
CFFTISTRPWMTQFSLLNKTCLEGFH
Download sequence
Identical sequences ENSGGOP00000014764 ENSGGOP00000014764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]