SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014768 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014768
Domain Number 1 Region: 224-260
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000142
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 144-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014768
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00105
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014768   Gene: ENSGGOG00000015131   Transcript: ENSGGOT00000015186
Sequence length 269
Comment pep:known_by_projection chromosome:gorGor3.1:7:96900788:96920746:1 gene:ENSGGOG00000015131 transcript:ENSGGOT00000015186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Download sequence
Identical sequences A0A096N5S3 A0A0D9RYX9 A0A2J8RUG3 A0A2K5CD84 A0A2K5HN52 A0A2K5MZ68 A0A2K5QYM9 A0A2K5YZY5 A0A2K6BYW5 A0A2K6SI70 F7BI49 G3RGL8 G7P0A7 O95639 U3BK11
ENSMMUP00000025225 ENSMMUP00000006978 ENSGGOP00000014768 9544.ENSMMUP00000025225 9606.ENSP00000292476 gi|5729939|ref|NP_006684.1| ENSP00000292476 ENSP00000395311 ENSP00000292476 HR6309 O95639 NP_006684.1.87134 NP_006684.1.92137 XP_004045874.1.27298 XP_005549196.1.63531 XP_008016853.1.81039 XP_010343077.1.74449 XP_010374072.1.97406 XP_011767153.1.29376 XP_011799190.1.43180 XP_011841184.1.47321 XP_011912505.1.92194 XP_012310940.1.9421 XP_014989801.1.72884 XP_017389176.1.71028 ENSPANP00000007786 ENSGGOP00000014768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]