SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014796 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014796
Domain Number 1 Region: 292-432
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-40
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 2 Region: 548-682
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-38
Family C-type lectin domain 0.000000106
Further Details:      
 
Domain Number 3 Region: 862-1000
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-36
Family C-type lectin domain 0.00019
Further Details:      
 
Domain Number 4 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.34e-35
Family Cysteine rich domain 0.000000804
Further Details:      
 
Domain Number 5 Region: 172-287
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-31
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 6 Region: 733-859
Classification Level Classification E-value
Superfamily C-type lectin-like 2.32e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 448-543
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-17
Family C-type lectin domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014796
Domain Number - Region: 692-725
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0636
Family C-type lectin domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014796   Gene: ENSGGOG00000015154   Transcript: ENSGGOT00000015218
Sequence length 1097
Comment pep:novel chromosome:gorGor3.1:10:18303523:18401387:1 gene:ENSGGOG00000015154 transcript:ENSGGOT00000015218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFASVIPGAVLLLDTRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEVEGSESLWNKDPLTSISYQINSKSAL
TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPF
RYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDV
PTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEEFDFIISQLGYEP
NDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRGC
EWPLGYICKMKSRSEGPEIVEVEKGCRKYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQ
WTIEEEVLFTHWNSDMPGRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPK
PTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQ
TIWRLITASGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELK
GDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVTYKDYQYYFSKE
KETMDPSLTNPPATIQTAGFIKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSN
AFAWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYW
KTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQA
SLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGTWLWINNSPVSFVN
WNTGDPSGERNDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTKADTRKM
DPSKPSSNVAGVVIIVILLILTGAGLAAYFFYKKRRVHLPQEGAFENTLYFNSQSSPGTS
DMKDLVGNIEQNEHSVI
Download sequence
Identical sequences ENSGGOP00000014796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]