SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014801 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014801
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.48e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 1770-1960
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.51e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1314-1448
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.12e-47
Family VBS domain 0.00000721
Further Details:      
 
Domain Number 4 Region: 701-837
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.1e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 5 Region: 550-683
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 8.47e-29
Family VBS domain 0.013
Further Details:      
 
Domain Number 6 Region: 263-365
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.12e-27
Family I/LWEQ domain 0.000062
Further Details:      
 
Domain Number 7 Region: 945-1031
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000115
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 1480-1607
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000022
Family VBS domain 0.02
Further Details:      
 
Domain Number 9 Region: 1172-1290
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000013
Family VBS domain 0.063
Further Details:      
 
Domain Number 10 Region: 420-518
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000049
Family I/LWEQ domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014801
Domain Number - Region: 1060-1135
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000267
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily PH domain-like 0.00779
Family Third domain of FERM 0.002
Further Details:      
 
Domain Number - Region: 1582-1704
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0327
Family I/LWEQ domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014801   Gene: ENSGGOG00000015139   Transcript: ENSGGOT00000015224
Sequence length 2016
Comment pep:known_by_projection chromosome:gorGor3.1:15:41908014:42054134:1 gene:ENSGGOG00000015139 transcript:ENSGGOT00000015224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKK
STILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPL
TSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVD
AITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGEDL
LRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGENETDERFQEMV
RQARVLAQATSDLVNAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPEN
EDQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNK
NPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSA
KAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNEL
QDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARET
AQALKTLAQAARGVAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQR
LAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQ
AAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGN
LKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECD
NALRELETVKGMLDNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGE
CVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDP
GSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIK
ALDGDFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAK
TMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYS
IDGINRCIRDIEQASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEA
AQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGG
NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPE
PKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAA
TAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVL
SALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKA
LVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIK
DVAKALSDLISATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRA
LEATIECIKQELTVFQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATA
NLSRKAVSDMLTACKQASFHPDVSDEMRTRALRFGTECTLGYLDLLEHVLVILQKPTPEL
KQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQ
LKPRAKPKQADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAAD
DGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVK
ADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQE
EMLKKERELEEARKKLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences ENSGGOP00000014801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]