SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014809 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014809
Domain Number 1 Region: 345-383
Classification Level Classification E-value
Superfamily SAP domain 0.000000000311
Family SAP domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014809   Gene: ENSGGOG00000015180   Transcript: ENSGGOT00000015232
Sequence length 931
Comment pep:known_by_projection chromosome:gorGor3.1:22:24742449:24966295:-1 gene:ENSGGOG00000015180 transcript:ENSGGOT00000015232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLK
LKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSS
DALSPEQPASHESQGSVPSPLEARVSEPLPSATSASPTQVVSQLPMGRDSREMLFLAEQP
PLPPPPLLPPSLTNGTTVPTAKSTPTLIKQSQPKSASEKSQRSKKAKELKPKVKKLKYHQ
YIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQQHHNYQAILPAPPKSAGEAL
GSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDMKVAELKQELK
LRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPATTSILHKAGEVVVAFPAARLSTGPA
LVAAGLAPTEVVVATVTSNGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMV
TSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRM
LRQKQQLVERLKLQLEQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSRQPLGPAHPFNPS
LAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPGLIKGIAPPTLIT
DSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSL
LKKEPPGYEEAMNQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPSLPGKEKPSPK
TVCGSPLAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLI
DDLHSQMLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVL
SLAPLSTTAPSLFSTDFLDGHDLQLHWDSCL
Download sequence
Identical sequences G3RGQ4
ENSGGOP00000014809 XP_004063559.1.27298 XP_018873986.1.27298 XP_018873990.1.27298 ENSGGOP00000014809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]