SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014813 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014813
Domain Number 1 Region: 116-496
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.33e-123
Family Choline/Carnitine O-acyltransferase 0.00000000000197
Further Details:      
 
Domain Number 2 Region: 498-710
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2e-79
Family Choline/Carnitine O-acyltransferase 0.00000000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014813   Gene: ENSGGOG00000015179   Transcript: ENSGGOT00000015237
Sequence length 736
Comment pep:known_by_projection chromosome:gorGor3.1:10:61406313:61461213:1 gene:ENSGGOG00000015179 transcript:ENSGGOT00000015237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGKKKRGGGGGGKSRREEALRVDSGGRELRSEVRPACFLQSGGRGDPGDVGGPAGNPGC
SPHPRAATXCGAAAAEAAERRRAGPHLCIPAPGLTKTPILEKVPHKMAAKTPSSEESGLP
KLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQRFGAPGGLGETLQQKLLERQEKTAN
WVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSH
SIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQF
FVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDS
TNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGR
DGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAPRRLRWKCSPEIQ
GHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVP
TYESASIRRFQEGRVDNIRSATPEALAFVRAMTDHKAAVPASEKLLLLKDALRAQTAYTV
MAITGMAIDNHLLALRELARAMCKELPEMFTDETYLMSNRFVLSTSQVPTTMEMFCCYGP
VVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKP
LAPKEKATRPSQGYQP
Download sequence
Identical sequences ENSGGOP00000014813 ENSGGOP00000014813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]