SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014877 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014877
Domain Number 1 Region: 294-625
Classification Level Classification E-value
Superfamily Pentein 4.32e-161
Family Peptidylarginine deiminase Pad4, catalytic C-terminal domain 0.00000000000369
Further Details:      
 
Domain Number 2 Region: 113-293
Classification Level Classification E-value
Superfamily Peptidylarginine deiminase Pad4, middle domain 4.71e-70
Family Peptidylarginine deiminase Pad4, middle domain 0.00000000982
Further Details:      
 
Domain Number 3 Region: 5-112
Classification Level Classification E-value
Superfamily Cupredoxins 1.7e-37
Family Peptidylarginine deiminase Pad4, N-terminal domain 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014877   Gene: ENSGGOG00000015246   Transcript: ENSGGOT00000015301
Sequence length 625
Comment pep:known_by_projection chromosome:gorGor3.1:1:17843337:17900990:1 gene:ENSGGOG00000015246 transcript:ENSGGOT00000015301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGTLIRVAPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKK
KSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCAD
ITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDEVLNSEDLQDM
SLMTLSTKTPKDFFTNHTLVLHVARSETDKVRVFQATRGKLSSKCSVVLGPKQPSHYLMV
PGGKHSMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
NTQPPQEVYACDEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQT
GGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQA
PVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGI
KKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSK
AEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHI
RHGEVHCGTNVRRKPFSFKWWNMVP
Download sequence
Identical sequences ENSGGOP00000014877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]