SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014920 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014920
Domain Number 1 Region: 378-606
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-60
Family DBL homology domain (DH-domain) 0.000000601
Further Details:      
 
Domain Number 2 Region: 59-215
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.41e-54
Family Regulator of G-protein signaling, RGS 0.0000000621
Further Details:      
 
Domain Number 3 Region: 607-741
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-38
Family Pleckstrin-homology domain (PH domain) 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014920   Gene: ENSGGOG00000015282   Transcript: ENSGGOT00000015346
Sequence length 948
Comment pep:known_by_projection chromosome:gorGor3.1:19:39199980:39225953:1 gene:ENSGGOG00000015282 transcript:ENSGGOT00000015346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSTWSSPAEPREMEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQ
FQSLEQVKRRPAHLMALLQHVALQFEPGPLVLRVPVPPNVAFELDRTRADLISEDVQRRF
VQEVVQSQQAAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLL
MHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEP
AKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPG
QDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESLAPPESTDEGAETESPEPG
DEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVL
HDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLA
RFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMI
PTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDY
QRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLL
QRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIY
ELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSENGNGGRETS
PADARTERILSDLLPFCRPGPEGQLAATALRKGVGGGILPPETPPVSAWGELCPPAWLHL
RFPPRKAFCKKERNGGEDVREHPHPHSCRSISHPEGLRRGSCGPRLGGAQLGLLAPHEPR
PSLPPALCLGDSGLHSGGHHGDPGHLSIACGGHPSTPTPKCLRSVFIP
Download sequence
Identical sequences G3RH05
ENSGGOP00000016836 ENSGGOP00000014920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]