SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014922 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014922
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-33
Family Calponin-homology domain, CH-domain 0.0000405
Further Details:      
 
Domain Number 2 Region: 185-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000166
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 214-244
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000385
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014922   Gene: ENSGGOG00000015295   Transcript: ENSGGOT00000015349
Sequence length 904
Comment pep:known_by_projection chromosome:gorGor3.1:7:1377102:1402712:-1 gene:ENSGGOG00000015295 transcript:ENSGGOT00000015349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFNALKKENIYE
NNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKR
ASEDSEEEPSGKKAPVQAAKLPSPAPARKLPLSPAQTNPVVQRRNEGAGGPPPKTDQALA
GSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTLHSGAYRATGEPGTFVCTS
HLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEANKARPSAWEPAAGNSPSRASV
PAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAAS
HPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTLSASRTQQARNKF
FQTSALPPGTSLAGRGPTPSLALSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAP
VPSSQPKTEAPQASPLAKPLQSSSPRALGLPSRMEPPAPLSMSSTSQGSSLPPAGRRNLA
ESSGVGRVGAGSRPKPEAPTAKGKSTTLTQDMSASPQEGQEDGPAGWRANLKPVDRRSPA
ERTLKPKEPQALAEPRAGEAPRKVSGSFAGSVHITLTPVRPDRTSRPASPGPSLPARSPS
PPRRRRLAVPASLDVSDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALP
GETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDSLMVD
WFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEDELRRLMAKPEALKSLQERRREQEL
LERYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKS
SPSQ
Download sequence
Identical sequences ENSGGOP00000014922 ENSGGOP00000014922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]