SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014928 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014928
Domain Number 1 Region: 295-406
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 8.6e-35
Family Transforming growth factor (TGF)-beta 0.00000595
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014928
Domain Number - Region: 32-45
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014928   Gene: ENSGGOG00000015308   Transcript: ENSGGOT00000015355
Sequence length 407
Comment pep:known_by_projection chromosome:gorGor3.1:2b:7176964:7182614:1 gene:ENSGGOG00000015308 transcript:ENSGGOT00000015355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPSPAAPPPPPPPGAPGGSQDTCTSCGG
FRRPEELGRVDGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGR
VEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWL
YLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNMVEKRVDLKRSGWHTFPLTEAIQALFE
RGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDGRT
NLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRM
RGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Download sequence
Identical sequences A0A2J8VM27 A0A2K6KE00 G3RH13
ENSGGOP00000014928 ENSGGOP00000014928 XP_004031753.1.27298 XP_017747486.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]