SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014939 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014939
Domain Number 1 Region: 170-297
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.59e-39
Family Nuclear movement domain 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014939   Gene: ENSGGOG00000015314   Transcript: ENSGGOT00000015366
Sequence length 336
Comment pep:known_by_projection chromosome:gorGor3.1:1:27871252:27895058:1 gene:ENSGGOG00000015314 transcript:ENSGGOT00000015366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKRRKAHLA
FLWHNSNFQQKRNAKASSLEKEPNEKVCFASKEAEEGVHKLKEGEKIKVVQLHLGALQLH
TTVRRERDEPPANFKVSLIRDLGPRPCGGTASAGESSLAYKGKLKPNLGNGADLPNYRWT
QTLSELDLAVPFHVNFRLKGKDVVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLI
EDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQR
QKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Download sequence
Identical sequences ENSGGOP00000014939 ENSGGOP00000014939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]