SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014987 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014987
Domain Number 1 Region: 39-62,91-379
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.63e-62
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 375-419
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000837
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014987   Gene: ENSGGOG00000015361   Transcript: ENSGGOT00000015415
Sequence length 421
Comment pep:known_by_projection chromosome:gorGor3.1:5:57081211:57100073:-1 gene:ENSGGOG00000015361 transcript:ENSGGOT00000015415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKL
VPWSQCLQNFLLHGTKNVTNSSSLRLQRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVP
EKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAP
DGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFL
WNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPP
PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFS
TDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQALPIPSKLLEFLSYR
V
Download sequence
Identical sequences G3RH71
ENSGGOP00000014987 ENSGGOP00000014987 XP_004042120.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]