SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015013 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015013
Domain Number 1 Region: 156-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000802
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015013
Domain Number - Region: 214-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000303
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015013   Gene: ENSGGOG00000015385   Transcript: ENSGGOT00000015442
Sequence length 385
Comment pep:novel chromosome:gorGor3.1:6:42993150:42999745:1 gene:ENSGGOG00000015385 transcript:ENSGGOT00000015442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPGEDPEDTHAQGPAVLSLGSLCLDTNQ
APNWTGLQTLLQQLPPQDIDERYCLALGEEERAELRLFCARRKQEALGQGVARLVLPKLE
GHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCGRH
HAELLRPRCPACDQLIFSWRCTEAEGQRWHENHFCCQDCAGPLGGGRYALPGGSPCCPSC
FENRYSDAGSSWAGALEGQAFLGETEPDRTEGRDQTSVNSATLSRTLLLAAAGGSSLQTQ
RGLPGSSPQQENRPGDKAEAPKGQEQCRLETIRDPKDTPFSTCSSSSDSEPEGFFLGERL
PQSWKTPRSLQAEDSNASKKHCTMC
Download sequence
Identical sequences ENSGGOP00000015013 ENSGGOP00000015013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]