SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015039 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015039
Domain Number 1 Region: 108-478
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.09e-77
Family Ankyrin repeat 0.00002
Further Details:      
 
Domain Number 2 Region: 585-633
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000589
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015039   Gene: ENSGGOG00000015416   Transcript: ENSGGOT00000015469
Sequence length 635
Comment pep:known_by_projection chromosome:gorGor3.1:14:75746328:75776926:-1 gene:ENSGGOG00000015416 transcript:ENSGGOT00000015469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQISTRGSQRTIGQEEYSLYSSLSEDELVQMAIEQSLADKTRGPTTAEATASACTNRQ
PAHFYPWTRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPVDPLIKAIKDGDEEA
LKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQRTLQEETAVYLAT
CRGHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHNADTNHRCNRGWT
ALHESVSRNDLEVMQILVSGGAKVESKNAYGITPLFVAAQSGQLEALRFLAKYGADINTQ
ASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKGNYRIVQMLLPVT
SRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTPLAPERARLYEDRRSSALYFAVV
NNNVYATELLLEHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANIDAYIATHPTAFPA
TIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVVQF
CEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAHLC
RLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
Download sequence
Identical sequences G3RHC1
ENSGGOP00000015039 ENSGGOP00000015039 XP_004055662.1.27298 XP_018865727.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]