SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015051 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015051
Domain Number 1 Region: 513-663
Classification Level Classification E-value
Superfamily EF-hand 1.75e-50
Family Osteonectin 0.00000203
Further Details:      
 
Domain Number 2 Region: 458-510
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.00054
Further Details:      
 
Domain Number 3 Region: 431-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000044
Family Follistatin (FS) module N-terminal domain, FS-N 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015051   Gene: ENSGGOG00000015425   Transcript: ENSGGOT00000015482
Sequence length 664
Comment pep:known_by_projection chromosome:gorGor3.1:4:96431668:96487943:-1 gene:ENSGGOG00000015425 transcript:ENSGGOT00000015482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGLFFLCLLGTAAAIPTNARLLADHSKPTAETVAPDNTAIPSLRAEDEENEKETAVST
EDDSHRKAEKSSVLKSKEESHGQSAEQGKSSSQELGLKDQEDSDGDLSVNLEYAPTEGTL
DIKEDMSEPQEKKLSENTDFLAPDVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQGLRDQGNQEQDPNISNGEEEEEKEPDEVGTHNDNQERKTELPREHANSKQEEDNTQS
DDILEESDQPTQVSKMQEDEFDLSNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETDEKTVSEVLLMEPTDDGNTMSRNHGADDDGGDDGDDGGNDGPRHSASDD
YFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTSEPGEHQEAKKAENSSNEEETS
SEGNMRVHGVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYA
SSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYE
ANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDE
NLLF
Download sequence
Identical sequences G3RHD3
XP_004039139.1.27298 XP_018880780.1.27298 ENSGGOP00000015051 ENSGGOP00000015051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]