SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015097 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015097
Domain Number 1 Region: 632-913
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.28e-66
Family Complement components 0.00013
Further Details:      
 
Domain Number 2 Region: 996-1104
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.09e-32
Family Alpha-macroglobulin receptor domain 0.00014
Further Details:      
 
Domain Number 3 Region: 511-587
Classification Level Classification E-value
Superfamily E set domains 0.0000000049
Family SVA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015097   Gene: ENSGGOG00000015469   Transcript: ENSGGOT00000015528
Sequence length 1112
Comment pep:novel chromosome:gorGor3.1:12:31526888:31575458:-1 gene:ENSGGOG00000015469 transcript:ENSGGOT00000015528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPQNNRIFQWQNVTSFRNITQLSFQLISEPMFGDYWIVVKRNSRKTVTHQFAVKRYVLPK
FEVTVNAPQTVTISDDEFQVDVCALKFSDPSNVPMVNKLLQLELNDEFIGNYTTDENGEA
QFSIDTSDIFDPEFNLKATYVRPKSCYLPSWLTPQYLDAHFLVSRFYSRTNSFLKIVPEP
KQLECNQQKVVTVHYSLNSEAYEDDSNVKFFYLVSLSHDSGNFQHRISSSPIYTTWNGNF
LFPISISADLAPAAVLFVYTLHPSGEIVADSVRFQVDKCFKHKVNIKFSNEQGLPGSNAS
LYLQAAPDLFCALGAVDRNVLLLKSEQQLSAESVYNMVPSIEPYGYCYHGLNLDDGKEDP
CIPQRDMFYNGLYYTPVSNCGDGDIYNIVRNMGLKVFTNLHYRKPEVCVMERRLPLPKPL
YLETENYGPMHSVPSRIACRGENADCVEQAIIQTVRTNFPETWMWDLVSVDSSGSANLLF
LIPDTVTQWEASGFCVNGDVGFGISSTTTLEVSQPFFIEIASPFSVVQNEQFDLIVNVFS
YLNTCVEISVQVEESQNYEANIHTWKINGSEVIQAGGRKTNIWTIIPKKLGAKASKQGVL
DLPNDVVEGSAGGFFTAVGDILGLAMQNLVVLQMPYGSGEQNAALLASDTYVLDYLKSTE
QLTEEAQSKAFFLLSNGYQRQLSFKNSDGSCSVFWKQNQKGSIWLSALTFKTLERMKKYV
FIDENVQKQTLIWLSSQQKTSGCFKNDGQLFNHAWEGGDEEDISLTAYVVEMFFEAGLNF
TFPALRNTLFCLEVALDSGVTDGYSHAILAYAFALAGKEKQVESLLQTLDQSAPKLNNVI
YWERERKPKTEEFPSFIPWAPSAQTEKSCYVLLAVISRKIPDLTYASKIVQWLAQWMNSH
GGFSSNQVIYVGLIFIAIGEEGLFSKNQNTVTFSSEGSSEIFQVNGHNRLLVQRSEVTQA
PGQYTVDVEGHGCTFIQATLKYNVLLPKKASGFSLSLEIVKNYSSTVFDLTVTLKYTGIC
NKSSMVVIDVKMLSGFTPTMSSIEELENKGQVMKTEVKNDHVLFYLENVFGRADSFTFSV
EQSNLVFNIQPAPVMVYDYYWKGGKAFLVTNR
Download sequence
Identical sequences ENSGGOP00000015097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]