SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015101 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015101
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.98e-24
Family THAP domain 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015101   Gene: ENSGGOG00000015483   Transcript: ENSGGOT00000015533
Sequence length 228
Comment pep:known_by_projection chromosome:gorGor3.1:12:70181864:70195110:1 gene:ENSGGOG00000015483 transcript:ENSGGOT00000015533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEAS
CFDLTGQTRRLKMDAVPTIFDFCTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQV
LLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANS
VLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI
Download sequence
Identical sequences H2Q6H0 Q9H0W7
GO.36654 ENSPTRP00000008878 ENSP00000310796 ENSPTRP00000008878 ENSGGOP00000015101 ENSP00000310796 gi|13899259|ref|NP_113623.1| NP_113623.1.87134 NP_113623.1.92137 XP_003313912.1.37143 XP_003832962.1.60992 ENSGGOP00000015101 ENSP00000310796 9598.ENSPTRP00000008878 9606.ENSP00000310796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]