SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015102 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015102
Domain Number 1 Region: 257-494
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-62
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 24-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015102   Gene: ENSGGOG00000015479   Transcript: ENSGGOT00000015534
Sequence length 506
Comment pep:known_by_projection chromosome:gorGor3.1:3:15459041:15491773:1 gene:ENSGGOG00000015479 transcript:ENSGGOT00000015534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLT
YSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMEWVRSFAKPLCSWDSKEKAIAPGCVG
QPEIRNINLISAWCDVFILSNDTALCPKLLKAKLFLNQHYNFIGLRVICVSVFIFNAETS
QGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPS
LADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESA
SRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAIVNH
LQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTS
TSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIGNV
SIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences ENSGGOP00000015102 ENSGGOP00000015102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]