SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015114 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015114
Domain Number 1 Region: 58-168,278-371,722-932
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-118
Family Calcium ATPase, transmembrane domain M 0.00023
Further Details:      
 
Domain Number 2 Region: 375-395,537-775
Classification Level Classification E-value
Superfamily HAD-like 1.97e-53
Family Meta-cation ATPase, catalytic domain P 0.0000872
Further Details:      
 
Domain Number 3 Region: 383-582
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.67e-42
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0015
Further Details:      
 
Domain Number 4 Region: 167-277
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.44e-25
Family Calcium ATPase, transduction domain A 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015114   Gene: ENSGGOG00000015486   Transcript: ENSGGOT00000015546
Sequence length 946
Comment pep:known_by_projection chromosome:gorGor3.1:16:74891533:75002346:1 gene:ENSGGOG00000015486 transcript:ENSGGOT00000015546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKC
QKEDLAKAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLG
SALVSVLTKEYEDAVSITTAVLIVVTVAFIQEYRSEKSLEELTKLVPPECNCLREGKLQH
LLARELVPGDVVSLSIGDRIPADIRLTEVMDLLVDESSFTGEAEPCSKTDSPLTGGGDLT
TLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAEETPKTPLQKSMDRLGKQLTL
FSFGIIGLIMLIGWLQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLGVLRMAKKRLI
VKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS
KEVIKEFSNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRK
KEIPFSSEQKWMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFC
LQEEKRMGSLGLRVLALASGPELGQLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMIT
GDALETALAIGRNIGLCNGKLQAMSGEEVDSVEKGELADRVGKVSVFFRTSPKHKLKIIK
ALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSKEAANMILVDDDFSAIMNAVE
EGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINIIMDGPPAQSLG
VEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFWKEMPEDRASTPRTTT
MTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQ
TENLGVLDLLFLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV
Download sequence
Identical sequences ENSGGOP00000015114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]