SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015118 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015118
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000497
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000144
Family Hairy Orange domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015118   Gene: ENSGGOG00000015498   Transcript: ENSGGOT00000015550
Sequence length 419
Comment pep:known_by_projection chromosome:gorGor3.1:12:26485867:26488615:-1 gene:ENSGGOG00000015498 transcript:ENSGGOT00000015550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGPGGGAAAAAAAL
LGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAARIAAAAAFPCLSSVLSPPP
EKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP
Download sequence
Identical sequences G3RHJ7
ENSGGOP00000015118 ENSGGOP00000015118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]