SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015163 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015163
Domain Number 1 Region: 161-343
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.09e-39
Family Complement components 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015163
Domain Number - Region: 62-96
Classification Level Classification E-value
Superfamily E set domains 0.0714
Family SVA-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015163   Gene: ENSGGOG00000015544   Transcript: ENSGGOT00000015598
Sequence length 360
Comment pep:novel chromosome:gorGor3.1:19:10240121:10272985:1 gene:ENSGGOG00000015544 transcript:ENSGGOT00000015598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRTLFPESWLWRKFTLPKSKSGISHYPISVKVPDSITMWQFVVVSLKAGQGLCVSDPF
ELTAMKSFFVELKLPSSVIRNEQVQIQAVLYNFRDRQAKVRVEFPHKETLCSASKPGAPS
RQAGVQIQQTSYSIVLEPQGQTQTKLVPRQEFLNMVPDTEAEVFISVQGYTRMLTHRSSD
GTSKGNPGSTWLTSYVFRVFALAYSTMTTQVLSLSSLCDMANWIIIDRQAEDGHFLEKGP
VVMTSMQGGHQGSEEDVSLTALVLIALNEGKELCRQKNLMASIERAYGFLERKLPDIRTT
FAVAIASYALALANSSQANDRLHSFASPSGCGMLLNQPQSWSGEGVISNPATCYSSLSVS
Download sequence
Identical sequences ENSGGOP00000015163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]